1.67 Rating by ClearWebStats
michiganfop.com is 1 decade 9 months 3 weeks old. This website has a #17,999,884 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, michiganfop.com is SAFE to browse.
Get Custom Widget

Traffic Report of Michiganfop

Daily Unique Visitors: 27
Daily Pageviews: 54

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 4

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 17,999,884
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
83
Siteadvisor Rating
View michiganfop.com site advisor rating Not Applicable

Where is michiganfop.com server located?

Hosted IP Address:

50.62.112.1 View other site hosted with michiganfop.com

Hosted Country:

michiganfop.com hosted country US michiganfop.com hosted country

Location Latitude:

33.6013

Location Longitude:

-111.8867

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View michiganfop.com HTML resources

Homepage Links Analysis

State Lodge of Michigan | FRATERNAL ORDER OF POLICE

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 3
H3 Headings: 13 H4 Headings: 5
H5 Headings: 6 H6 Headings: 1
Total IFRAMEs: Not Applicable Total Images: 19
Google Adsense: Not Applicable Google Analytics: UA-5387403-2

Websites Hosted on Same IP (i.e. 50.62.112.1)

Employment Search | Start your job search with Employment News

michiganfop.com favicon - employmentnews.com

Employment News offers daily access to hundreds of job listings locally and across Canada: find a job and begin your next career. Post a resume, and respond to job listings for the Greater Toronto Area and Ottawa region. Also search for career training opportunities, get educated, and go for your dream job today.

View michiganfop.com Pagerank   michiganfop.com alexa rank 554,757   michiganfop.com website value $ 1,200.00

Camp Kesem

michiganfop.com favicon - campkesem.org

View michiganfop.com Pagerank   michiganfop.com alexa rank 765,254   michiganfop.com website value $ 960.00

Ülemaailmne Eesti Kesknõukogu

michiganfop.com favicon - uekn.org

View michiganfop.com Pagerank   michiganfop.com alexa rank Not Applicable   michiganfop.com website value $ 8.95

Create recurring sustainable incremental digital advertising profits with daily deal, customer loyalty, customer referral, mobile applications, auction, reverse auction, and social shopping game...

michiganfop.com favicon - shoutbackconcepts.com

More than a software solution, Shoutback Concepts’ daily deals, customer loyalty, customer referral, satisfaction survey, auctions, digital classifieds, online marketplace and social shopping games are both a white label or private branded applications that provide your publication, radio station, television station, or website an opportunity to add incremental revenue without any upfront investment and minimal turnaround time for start up.

View michiganfop.com Pagerank   michiganfop.com alexa rank 4,294,676   michiganfop.com website value $ 240.00

Fort Wayne Children's Zoo

michiganfop.com favicon - kidszoo.org

View michiganfop.com Pagerank   michiganfop.com alexa rank 1,449,990   michiganfop.com website value $ 480.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 22 Nov 2014 17:40:34 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://michiganfop.com/xmlrpc.php
Link: ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 7278
Content-Type: text/html; charset=UTF-8

Domain Information for michiganfop.com

Domain Registrar: GODADDY.COM, LLC michiganfop.com registrar info
Registration Date: 2013-06-26 1 decade 9 months 3 weeks ago
Last Modified: 2014-05-26 9 years 11 months 1 day ago
Expiration Date: 2015-06-26 8 years 9 months 4 weeks ago

Domain Nameserver Information

Host IP Address Country
ns51.domaincontrol.com michiganfop.com name server information 97.74.105.26 michiganfop.com server is located in United States United States
ns52.domaincontrol.com michiganfop.com name server information 173.201.73.26 michiganfop.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
michiganfop.com A 595 IP:50.62.112.1
michiganfop.com NS 3599 Target:ns52.domaincontrol.com
michiganfop.com NS 3599 Target:ns51.domaincontrol.com
michiganfop.com SOA 3599 MNAME:ns51.domaincontrol.com
RNAME:dns.jomax.net
Serial:2014092600
Refresh:28800
Retry:7200
Expire:604800
michiganfop.com MX 3599 Target:smtp.secureserver.net
michiganfop.com MX 3599 Priority:10
Target:mailstore1.secureserver.net
michiganfop.com TXT 3599 TXT:google-site-verification=dX7cNg0TAX_LYqj
AqVRSfIQfaaTOz9Gw5yg0jRSUlb4

Similarly Ranked Websites to Michiganfop

Bedrijvig Stadskanaal de promotie website waar verschillende bedrijven uit Stadskanaal zich aan u voorstellen.

michiganfop.com favicon - bedrijvigstadskanaal.nl

Bedrijvig Stadskanaal de promotie website waar verschillende bedrijven uit Stadskanaal zich aan u voorstellen.

View michiganfop.com Pagerank   Alexa rank for michiganfop.com 17,999,894   website value of michiganfop.com $ 8.95

Welkom bij Bel1649.nl!

michiganfop.com favicon - bel1649.nl

Via 1649 kun je goedkoop bellen naar het buitenland. Meld je gratis aan via de site en profiteer direkt van onze lage telefoontarieven naar onder andere Engeland, USA, Belgie, Duitsland, Frankrijk, Suriname, Thailand, Marokko, Turkije en nog veel meer internationale bestemmingen.

View michiganfop.com Pagerank   Alexa rank for michiganfop.com 17,999,907   website value of michiganfop.com $ 8.95

Stephen Curry Shoes_Curry 2_Men's UA Curry 3 Basketball Shoes

michiganfop.com favicon - curry2.men

Shop Under Armour Steph Curry shoes at Champs Sports. The two-time MVP's shoes are as elite as he is.Shop Stephen Curry shoes at our store.Shop Steph Curry shoes at Eastbay. The Curry 1, Curry 2 & Curry 2.5 come in a wide range of colors. The Under Armour Curry basketball shoes are Steph Curry's 1st signature shoe and available here!

View michiganfop.com Pagerank   Alexa rank for michiganfop.com 17,999,907   website value of michiganfop.com $ 8.95

MSE

michiganfop.com favicon - schoolforentrepreneurship.com

View michiganfop.com Pagerank   Alexa rank for michiganfop.com 17,999,908   website value of michiganfop.com $ 8.95

Bethlehem Pennsylvania Classifieds

michiganfop.com favicon - bethlehempennsylvaniaclassifieds.com

Post your Bethlehem Pennsylvania classified ad with Photos. You can buy, sell, advertise or promote with Bethlehem Pennsylvania Classifieds.

View michiganfop.com Pagerank   Alexa rank for michiganfop.com 17,999,912   website value of michiganfop.com $ 8.95